PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART10G00640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BBR-BPC
Protein Properties Length: 345aa    MW: 38152.5 Da    PI: 10.0992
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART10G00640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind405.66.1e-12413411300
        GAGA_bind   1 mdddgsre.rnkg.yyepaaslkenlglqlmssia.erdaki...........rernlalsekkaavaerd....................... 57 
                      mddd+s++ r +g ++e+    ++nlglqlmss++ +rd+k+           +++++  +++++++++rd                       
  OBART10G00640.1   1 MDDDASMSiR-WGgFFESP---ARNLGLQLMSSVPaDRDTKQllsgspflhhqHQQQHVPHHHHQPHHPRDcgangnanggamppppateapps 90 
                      9*******66.777***99...88**********99***************99777777*********************************** PP

        GAGA_bind  58 ..maflqrdkalae..rnkalverdnkllalllvensla...salpvgvqvlsgtksidslqqlsepqledsave.lreeeklealpieeaaee 143
                        m+f+++d++++   +++++++r++k+l++l+v ++++   +++pvg+++++gt++++++qq++epq ++++ + +++ee+++++ iee++++
  OBART10G00640.1  91 mpMNFVRSDMWMHPqqQQQHHHPREHKVLHNLTVGHGSShiaHHDPVGYGMIPGTHTLQMMQQQTEPQPQPPPLPqQPKEECISSPLIEENVPV 184
                      ************9754778999**************9988999******************************99899**************** PP

        GAGA_bind 144 akekkkkkkrqrakkpkekkakkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCt 236
                      ++e + +kkrq++++pk+++akk+kk s++++++ ++++a+ +r++ ++k+i++v+ng++lD s++P+PvCsCtGa++qCY+WG+GGWqSaCCt
  OBART10G00640.1 185 IDEPPPPKKRQQGRQPKVPRAKKPKK-SAAPREDGAPPNAPaPRRRGPRKNIGMVINGIDLDLSRIPTPVCSCTGAPQQCYRWGAGGWQSACCT 277
                      **************************.88999*******999**************************************************** PP

        GAGA_bind 237 ttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvti 300
                      ttiS+yPLP+stkrrgaRiagrKmS+gafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvti
  OBART10G00640.1 278 TTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTI 341
                      ***************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012267.5E-1991342IPR010409GAGA-binding transcriptional activator
PfamPF062178.8E-1181341IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MDDDASMSIR WGGFFESPAR NLGLQLMSSV PADRDTKQLL SGSPFLHHQH QQQHVPHHHH  60
QPHHPRDCGA NGNANGGAMP PPPATEAPPS MPMNFVRSDM WMHPQQQQQH HHPREHKVLH  120
NLTVGHGSSH IAHHDPVGYG MIPGTHTLQM MQQQTEPQPQ PPPLPQQPKE ECISSPLIEE  180
NVPVIDEPPP PKKRQQGRQP KVPRAKKPKK SAAPREDGAP PNAPAPRRRG PRKNIGMVIN  240
GIDLDLSRIP TPVCSCTGAP QQCYRWGAGG WQSACCTTTI STYPLPMSTK RRGARIAGRK  300
MSHGAFKKVL EKLAGEGYNL NNPIDLKTFW AKHGTNKFVT ISCLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126180.0CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612731.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612730.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612727.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612725.10.0PREDICTED: barley B recombinant-like protein A
SwissprotP0DH880.0BBRA_ORYSJ; Barley B recombinant-like protein A
SwissprotP0DH890.0BBRB_ORYSJ; Barley B recombinant-like protein B
TrEMBLA0A0D3HAK60.0A0A0D3HAK6_9ORYZ; Uncharacterized protein
STRINGBGIOSGA032378-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.33e-59basic pentacysteine 2